LOCUS       HUMPTH2      1156 bp    DNA             PRI       08-JAN-1995
DEFINITION  Human parathyroid (pth) gene: coding region and 3'flank.
ACCESSION   J00301
NID         g190702
KEYWORDS    Z DNA; hormone; parathyroid hormone.
SEGMENT     2 of 2
SOURCE      human cdna of parathyroid mrna([1]) & fetal liver dna([2]).
  ORGANISM  Homo sapiens
            Eukaryotae; mitochondrial eukaryotes; Metazoa; Chordata;
            Vertebrata; Eutheria; Primates; Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 108 to 198; 302 to 913)
  AUTHORS   Hendy,G.N., Kronenberg,H.M., Potts,J.T. Jr. and Rich,A.
  TITLE     Nucleotide sequence of cloned cDNAs encoding human
            preproparathyroid hormone
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 78 (12), 7365-7369 (1981)
  MEDLINE   82150870
REFERENCE   2  (bases 1 to 1156)
  AUTHORS   Vasicek,T.J., McDevitt,B.E., Freeman,M.W., Fennick,B.J.,
            Hendy,G.N., Potts,J.T. Jr., Rich,A. and Kronenberg,H.M.
  TITLE     Nucleotide sequence of the human parathyroid hormone gene
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 80 (8), 2127-2131 (1983)
  MEDLINE   83169834
COMMENT     see comment for humpth1. the 3' noncoding region is 120 bases
            longer than in bovine pth mrna (see bovpth) and contains two aataaa
            signal sequences for polyadenylation.
FEATURES             Location/Qualifiers
     source          1..1156
                     /organism="Homo sapiens"
                     /db_xref="taxon:9606"
                     /map="11p15.2-p15.1"
     gene            join(J00300:282..526,1..563)
                     /gene="PTH"
     intron          <1..107
                     /gene="PTH"
                     /note="pth intron 1"
     prim_transcript <1..913
                     /note="pth mRNA"
     exon            <113..198
                     /gene="PTH"
                     /note="preproparathyroid hormone; G00-119-522"
     CDS             join(113..198,302..563)
                     /gene="PTH"
                     /note="preproparathyroid hormone"
                     /codon_start=1
                     /db_xref="GDB:G00-119-522"
                     /db_xref="PID:g190704"
                     /translation="MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGK
                     HLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEAD
                     KADVNVLTKAKSQ"
     sig_peptide     116..187
                     /gene="PTH"
                     /note="prepeptide"
     intron          199..301
                     /gene="PTH"
                     /note="pth intron 2"
     exon            302..>563
                     /gene="PTH"
                     /note="preproparathyroid hormone"
     mat_peptide     309..560
                     /gene="PTH"
                     /note="parathyroid hormone"
BASE COUNT      371 a    188 c    210 g    387 t
ORIGIN      HindIII site, about 3400 bp downstream from humpth1;chr.
        1 aagcttctcg tgaaaaccaa cccaattagt tagtattgca ttctgtgtac tatagtttgg
       61 aatattaaaa atattttaaa atacctccat tttgcttatc cttttagtga agatgatacc
      121 tgcaaaagac atggctaaag ttatgattgt catgttggca atttgttttc ttacaaaatc
      181 ggatgggaaa tctgttaagt aagtactgtt ttgccttgga attggatttt taatgttgac
      241 tttatcattt cgaagtgggg agctaatggg aagtggccct ctctgtttct cttcttccca
      301 ggaagagatc tgtgagtgaa atacagctta tgcataacct gggaaaacat ctgaactcga
      361 tggagagagt agaatggctg cgtaagaagc tgcaggatgt gcacaatttt gttgcccttg
      421 gagctcctct agctcccaga gatgctggtt cccagaggcc ccgaaaaaag gaagacaatg
      481 tcttggttga gagccatgaa aaaagtcttg gagaggcaga caaagctgat gtgaatgtat
      541 taactaaagc taaatcccag tgaaaatgaa aacagatatt gtcagagttc tgctctagac
      601 agtgtagggc aacaatacat gctgctaatt caaagctcta ttaagatttc caagtgccaa
      661 tatttctgat ataacaaact acatgtaatc catcactagc catgataact gcaattttaa
      721 ttgattattc tgattccact tttattcatt tgagttattt taattatctt ttctattgtt
      781 tattcttttt aaagtatgtt attgcataat ttataaaaga ataaaattgc acttttaaac
      841 ctctcttcta ccttaaaatg taaaacaaaa atgtaatgat cataagtcta aataaatgaa
      901 gtatttctca ctcattgcaa gtatatcttt ttggttatca ctgataccca catgtttaca
      961 ttgatcatga ctaggtagaa caatacaaag tattttttta gtcatgtgtt tcacatttgg
     1021 atattttgaa catcaacgtt ttagtattac caaagtatta ggtttccaaa tcttcactag
     1081 ctcaatactg ttgtcctttt ggtttcagga aaggaaataa aatgctcagc aaaaaaaggg
     1141 ggcataaaag tggacc
//