LOCUS       HUMSAP01     1394 bp    DNA             PRI       20-JAN-1992
DEFINITION  Human serum amyloid P component (SAP) gene with upstream promoter.
ACCESSION   D00097
NID         g220067
KEYWORDS    SAP; pentraxins; serum amyloid P component.
SOURCE      Human placenta DNA, clone Lm hSAP-8; Human liver, cDNA to mRNA,
            clone phSAP-1.
  ORGANISM  Homo sapiens
            Eukaryotae; mitochondrial eukaryotes; Metazoa; Chordata;
            Vertebrata; Mammalia; Eutheria; Primates; Catarrhini; Hominidae;
            Homo.
REFERENCE   1  (sites)
  AUTHORS   Mantzouranis,E.C., Dowton,S.B., Whitehead,A.S., Edge,M.D.,
            Bruns,G.A. and Colten,H.R.
  TITLE     Human serum amyloid P component. cDNA isolation, complete sequence
            of pre-serum amyloid P component, and localization of the gene to
            chromosome 1
  JOURNAL   J. Biol. Chem. 260 (12), 7752-7756 (1985)
  MEDLINE   85207828
REFERENCE   2  (bases 1 to 1394)
  AUTHORS   Ohnishi,S., Maeda,S., Shimada,K. and Arao,T.
  TITLE     Isolation and characterization of the complete complementary and
            genomic DNA sequences of human serum amyloid P component
  JOURNAL   J. Biochem. 100 (4), 849-858 (1986)
  MEDLINE   87137351
COMMENT     In [J. Biochem. 100, 849-858 (1986)], they isolated the human SAP
            cDNA and genomic DNA clones,
            elucidated the nucleotide sequences, and assigned the cap site of
            the SAP gene which was not done in [1]. In addition, they compared
            the genomic DNA sequence of human SAP with that of the reported
            human CRP.
FEATURES             Location/Qualifiers
     source          1..1394
                     /organism="Homo sapiens"
                     /db_xref="taxon:9606"
     TATA_signal     143..149
     exon            172..331
                     /note="serum amyloid P component (SAP), exon 1"
     prim_transcript 172..1210
     CDS             join(268..331,447..1054)
                     /partial
                     /note="serum amyloid P component"
                     /codon_start=1
                     /db_xref="PID:d1000504"
                     /db_xref="PID:g220068"
                     /translation="MNKPLLWISVLTSLLEAFAHTDLSGKVFVFPRESVTDHVNLITP
                     LEKPLQNFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVTSK
                     VIEKFPAPVHICVSWESSSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYG
                     GKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIK
                     PLVWV"
     sig_peptide     271..324
                     /partial
                     /note="SAP signal peptide"
     mat_peptide     join(325..331,447..1051)
                     /note="SAP mature peptide"
     intron          332..446
                     /note="SAP cds intron"
     exon            447..1210
                     /note="SAP, exon 2"
     misc_feature    533..541
                     /note="N-linked glycosylation site (putative)"
     conflict        565
                     /note="t in [J. Biochem. 100, 849-858 (1986)]; c in [1]"
                     /citation=[1]
     conflict        682
                     /note="a in [J. Biochem. 100, 849-858 (1986)]; t in [1]"
                     /citation=[1]
     conflict        683
                     /note="t in [J. Biochem. 100, 849-858 (1986)]; c in [1]"
                     /citation=[1]
     conflict        685
                     /note="c in [J. Biochem. 100, 849-858 (1986)]; a in [1]"
                     /citation=[1]
     misc_feature    767..775
                     /note="N-linked glycosylation site (putative)"
     conflict        814
                     /note="g in [J. Biochem. 100, 849-858 (1986)]; a in [1]"
                     /citation=[1]
     conflict        943
                     /note="t in [J. Biochem. 100, 849-858 (1986)]; c in [1]"
                     /citation=[2]
     polyA_signal    1182..1187
                     /note="polyadenylation signal of SAP gene (putative)"
     polyA_site      1210
BASE COUNT      375 a    312 c    302 g    405 t
ORIGIN      171 bp upstream of 5' end of SAP mRNA.
        1 agccatcact tgtctctaat aaataactcc cattgatttt ccagctcagg gctcaccact
       61 ccttaccgta agcgcaggag gagactggaa aatcactcac atattattgg tgctcttcct
      121 cccccatcct cacccaaggt gcatataaac cctgaataac ctgaagtcta agggcatgaa
      181 tatcagacgc tagggggaca gccactgtgt tgtctgctac cctcatcctg gtcactgctt
      241 ctgctataac agccctaggc caggaatatg aacaagccgc tgctttggat ctctgtcctc
      301 accagcctcc tggaagcctt tgctcacaca ggtaaggagg tgaaggaatg gtcaagaatc
      361 ataaagtgag aaaataggtt gaagctgaga tatcttttcc ctgcatttat actgaaggtc
      421 attatctttc tttctttatc ccgcagacct cagtgggaag gtgtttgtat ttcctagaga
      481 atctgttact gatcatgtaa acttgatcac accgctggag aagcctctac agaactttac
      541 cttgtgtttt cgagcctata gtgatctctc tcgtgcctac agcctcttct cctacaatac
      601 ccaaggcagg gataatgagc tactagttta taaagaaaga gttggagagt atagtctata
      661 cattggaaga cacaaagtta catccaaagt tatcgaaaag ttcccggctc cagtgcacat
      721 ctgtgtgagc tgggagtcct catcaggtat tgctgaattt tggatcaatg ggacaccttt
      781 ggtgaaaaag ggtctgcgac agggttactt tgtggaagct cagcccaaga ttgtcctggg
      841 gcaggaacag gattcctatg ggggcaagtt tgataggagc cagtcctttg tgggagagat
      901 tggggatttg tacatgtggg actctgtgct gcccccagaa aatatcctgt ctgcctatca
      961 gggtacccct ctccctgcca atatcctgga ctggcaggct ctgaactatg aaatcagagg
     1021 atatgtcatc atcaaaccct tggtgtgggt ctgaggtctt gactcaacga gagcacttga
     1081 aaatgaaatg actgtctaag agatctggtc aaagcaactg gatactagat cttacatctg
     1141 cagtctttct tctttgaatt tcctatctgt atgtctgcct aattaaaaaa atatatattg
     1201 tattatgcta cctgcatttg tttagtgctt gtcatagtcc catatcttta tcttatgtct
     1261 actacttatc tatctactaa ttggtgtttc attggtaatt ggtgtttcat tatcctgaaa
     1321 actccaattg ccaagtacgg ggaggaaaac ctgtaagtaa ctagaaagat atatcgcaaa
     1381 gccagagcac tcaa
//